PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 242aa    MW: 27500.6 Da    PI: 6.5077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41181.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+  v+ +G ++W+  ++  g+ R++k+c++rw +yl
       KHN41181.1 15 KGTWTPEEDWKLIAHVNAHGHKNWRQLPKLAGLARCGKSCRLRWVNYL 62
                     799*******************************************97 PP

2Myb_DNA-binding50.74e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T eE+e ++++ + lG++ W+ Ia++++ gR+++++k++w+ +
       KHN41181.1  68 RGNYTHEEEETIIKLRTSLGNR-WSVIASHLP-GRSDNEIKNHWHAH 112
                      899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.21066IPR017930Myb domain
SuperFamilySSF466893.0E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002497.6E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-221669IPR009057Homeodomain-like
CDDcd001677.80E-101762No hitNo description
PROSITE profilePS5129417.55267117IPR017930Myb domain
SMARTSM007175.9E-1567115IPR001005SANT/Myb domain
PfamPF002499.3E-1468112IPR001005SANT/Myb domain
CDDcd001672.14E-1070113No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2470116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVKTPYCDKK SGLKKGTWTP EEDWKLIAHV NAHGHKNWRQ LPKLAGLARC GKSCRLRWVN  60
YLRPGIKRGN YTHEEEETII KLRTSLGNRW SVIASHLPGR SDNEIKNHWH AHLKKRFQHD  120
EASTPKLHLS TVESIQENNY SVEVDPSPFQ NSSPATYDAS PSSHHTSMSD FSSMITEPAS  180
ASSDGNLVID GFADFTEENT DPISAYSWEE LYEISYFSGE FLAPFVTEPQ SFCPVYDVWG  240
LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-35AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014632647.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0B2S3730.0A0A0B2S373_GLYSO; Myb-related protein Myb4
TrEMBLK7KY810.0K7KY81_SOYBN; Uncharacterized protein
STRINGGLYMA06G45570.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.13e-57myb domain protein 74
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]